Name: Cagrilintide
Brand: Aminopia
SKU: CAGRILINTIDE
Price: 68 USD
Availability: InStock

Cagrilintide is a long-acting, lipidated 37-residue amylin analogue that behaves as a non-selective agonist across calcitonin-family G protein-coupled receptors, including the calcitonin receptor (CTR) and the AMY1-3 amylin receptors formed by CTR with RAMP1-3. Its receptor pharmacology has been profiled in recombinant cell systems against selective and non-selective calcitonin-family agonists, and it has been investigated in preclinical rodent models for food-intake and pharmacokinetic endpoints, where the C20 diacid-γGlu acylation confers albumin binding and an extended half-life. It is an investigational compound and is supplied for in vitro and preclinical research use only.

Purity: ≥ 99%
Form: Lyophilized powder
Class: Acylated long-acting amylin analogue
Storage: −20 °C, desiccated, dark

Also known as AM833, NN0174-0833, NNC0174-0833.

The research interest

How an appetite-related signalling compound is designed.

What was studied

The selected paper concerns the design and properties of cagrilintide.

Evidence context

This summary covers compound design. Product testing and a full clinical review are separate assessments.

Selected-source check, not a complete clinical review. No human-use recommendation.

Linear peptide, 37 residues. Blue basic · light blue acidic · gray polar · light gray nonpolar.

1KCNTATCATQ

11RLAEFLRHSS

21NNFGPILPPT

31NVGSNTP

37 residues · (Eicosanedioic acid-γGlu)-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2. Intramolecular disulfide bridge between Cys2 and Cys7 (peptide numbering). N-terminal Lys1 acylated with eicosanedioic (C20) diacid via a γ-Glu linker; no AEEA spacer. C-terminal amide. Backbone is an aggregation-resistant, pramlintide-like human amylin analogue.

Identity

CAS number: 1415456-99-3
Formula: C194H312N54O59S2
Molecular weight: 4409.1 g/mol
Chain length: 37 residues

Material

Purity, RP-HPLC: ≥ 99%
Form: Lyophilized powder
Appearance: White to off-white lyophilized powder
Vial sizes: 5 mg, 10 mg

Handling

Solubility: Water approximately 100 mg/mL with sonication; slightly soluble in DMSO (approximately 0.1-1 mg/mL) and sparingly soluble in PBS pH 7.2 (approximately 1-10 mg/mL) per supplier characterisation.
Storage: Lyophilized powder sealed, under nitrogen, protected from light and moisture: -20 °C for approximately 1 year, -80 °C for approximately 2 years. Reconstituted stocks: -80 °C for approximately 6 months. Avoid repeated freeze-thaw cycles.

Development of Cagrilintide, a Long-Acting Amylin AnaloguePMID 34288673 · 2021
AM833 Is a Novel Agonist of Calcitonin Family G Protein-Coupled Receptors: Pharmacological Comparison with Six Selective and Nonselective AgonistsPMID 33727283 · 2021

Citations describe published preclinical and in-vitro findings for this compound class and are not a representation about this material.

Research use only

All products listed on this site are supplied strictly as chemical reference materials for in-vitro laboratory research and are labelled For Research Use Only. They are not drugs, foods, cosmetics, or medical devices. They are not intended to diagnose, treat, cure, or prevent any condition, and are not for human or veterinary consumption or administration under any circumstances.

Research use policy ›

Overview

Research explained